Aspartate beta hydroxylase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69229

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Aspartate beta hydroxylase Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ASPH(aspartate beta-hydroxylase) The peptide sequence was selected from the N terminal of ASPH. Peptide sequence MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVD. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Aspartate beta hydroxylase Antibody - BSA Free

Western Blot: Aspartate beta hydroxylase Antibody [NBP1-69229]

Western Blot: Aspartate beta hydroxylase Antibody [NBP1-69229]

Western Blot: Aspartate beta hydroxylase Antibody [NBP1-69229] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml ASPH is supported by BioGPS gene expression data to be expressed in 721_B
Western Blot: Aspartate beta hydroxylase Antibody [NBP1-69229]

Western Blot: Aspartate beta hydroxylase Antibody [NBP1-69229]

Western Blot: Aspartate beta hydroxylase Antibody [NBP1-69229] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Aspartate beta hydroxylase Antibody [NBP1-69229]

Western Blot: Aspartate beta hydroxylase Antibody [NBP1-69229]

Western Blot: Aspartate beta hydroxylase Antibody [NBP1-69229] - Antibody Titration: 0.2-1 ug/ml. A: - blocking peptide. B: + blocking peptide.
Western Blot: Aspartate beta hydroxylase Antibody [NBP1-69229]

Western Blot: Aspartate beta hydroxylase Antibody [NBP1-69229]

Western Blot: Aspartate beta hydroxylase Antibody [NBP1-69229] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml

Applications for Aspartate beta hydroxylase Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aspartate beta hydroxylase

ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.This gene is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.

Alternate Names

AAH, ASP beta-hydroxylase, aspartate beta-hydroxylaseA beta H-J-J, aspartyl/asparaginyl-beta-hydroxylase, BAH, cardiac junctin, CASQ2BP1, EC 1.14.11.16, HAAHaspartyl/asparaginyl beta-hydroxylase, humbug, JCTN, junctate, junctin, Peptide-aspartate beta-dioxygenase

Gene Symbol

ASPH

Additional Aspartate beta hydroxylase Products

Product Documents for Aspartate beta hydroxylase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Aspartate beta hydroxylase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Aspartate beta hydroxylase Antibody - BSA Free

Customer Reviews for Aspartate beta hydroxylase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Aspartate beta hydroxylase Antibody - BSA Free and earn rewards!

Have you used Aspartate beta hydroxylase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies