ASXL2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58342

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ASXL2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NATGESSSSKEDDTDEESTGDEQESVTVKEEPQVSQSAGKGDTSSGPHSRETLSTSDCLASKNVKAEIPLNEQTTLSKENYLFTRGQTFDEKTLAR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ASXL2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ASXL2 Antibody [NBP2-58342]

Immunocytochemistry/ Immunofluorescence: ASXL2 Antibody [NBP2-58342]

Immunocytochemistry/Immunofluorescence: ASXL2 Antibody [NBP2-58342] - Staining of human cell line A-431 shows localization to nucleoplasm.

Applications for ASXL2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ASXL2

The gene that encodes Additional sex combs-like protein 2 (ASXL2) is a homolog of the drosophila additional sex combs (Asx) gene. Drosophila Asx is in a class of proteins known as ETP (enhancers of trithorax and polycomb). ETP proteins regulate polycomb-group (PcG) and trithorax-group (trxG) proteins which function to modify the methylation of histones and structure of chromatin. Mutations in ASXL1 are implicated in the development of myelodysplastic syndromes (MDS), a group of hematological diseases characterized by ineffective hematopoiesis and a predisposition to acute myeloid leukemia (AML). Alternate names for ASXL2 include ASXH2 and KIAA1685.

Alternate Names

additional sex combs like 2 (Drosophila), Additional sex combs-like protein 2, ASXH2polycomb group protein ASXH2, FLJ10898, KIAA1685DKFZp686C1968, putative Polycomb group protein ASXL2

Gene Symbol

ASXL2

Additional ASXL2 Products

Product Documents for ASXL2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ASXL2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ASXL2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ASXL2 Antibody - BSA Free and earn rewards!

Have you used ASXL2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies