Ataxin-3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87047

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human Ataxin-3. Peptide sequence: SIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNAL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Ataxin-3 Antibody - BSA Free

Western Blot: Ataxin-3 Antibody [NBP2-87047]

Western Blot: Ataxin-3 Antibody [NBP2-87047]

Western Blot: Ataxin-3 Antibody [NBP2-87047] - Lanes: Lane 1: 2ug hATX3 (isoform2); Josephin domain(1-182). Lane 2: 2ug hATX3 (isoform2); C-terminal truncated Atx3 (1-264). Lane 3: 2ug hATX3 (isoform2). Lane 4: 2ug other protein. Primary Antibody Dilution: 1:10,000. Secondary Antibody: Anti-rabbit HRP. Secondary Antibody Dilution: 1:20,000. Gene Name: ATXN3. Submitted by: Dr. Maria Macedo, Instituto de Biologia Molecular e Celular.
Western Blot: Ataxin-3 Antibody [NBP2-87047]

Western Blot: Ataxin-3 Antibody [NBP2-87047]

Western Blot: Ataxin-3 Antibody [NBP2-87047] - WB Suggested Anti-ATXN3 Antibody Titration: 0.2-1 ug/ml. Positive Control: 293T cell lysate

Applications for Ataxin-3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ataxin-3

Machado-Joseph disease, also known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein encoded by this gene contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. (provided by RefSeq)

Alternate Names

AT3, Ataxin3, ATXN3, JOS, MJD1, SCA3

Gene Symbol

ATXN3

Additional Ataxin-3 Products

Product Documents for Ataxin-3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ataxin-3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Ataxin-3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ataxin-3 Antibody - BSA Free and earn rewards!

Have you used Ataxin-3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...