ATP5H Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79479

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ATP5H Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human ATP5HThe immunogen for this antibody is ATP5H. Peptide sequence CAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKY. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ATP5H Antibody - BSA Free

Western Blot: ATP5H Antibody [NBP1-79479]

Western Blot: ATP5H Antibody [NBP1-79479]

Western Blot: ATP5H Antibody [NBP1-79479] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: ATP5H Antibody [NBP1-79479]

Western Blot: ATP5H Antibody [NBP1-79479]

Western Blot: ATP5H Antibody [NBP1-79479] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Applications for ATP5H Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP5H

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, F0, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The F0 seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the d subunit of the F0 complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. In addition, three pseudogenes are located on chromosomes 9, 12 and 15. [provided by RefSeq]

Alternate Names

ATP synthase D chain, mitochondrial, ATP synthase subunit d, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d, ATP synthase, H+ transporting, mitochondrial F1F0, subunit d, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d, ATP5JD, ATPase subunit d, ATPQ, My032 protein

Gene Symbol

ATP5PD

UniProt

NP_006347 (Human)

Additional ATP5H Products

Product Documents for ATP5H Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ATP5H Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATP5H Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATP5H Antibody - BSA Free and earn rewards!

Have you used ATP5H Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies