ATP5L Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92577

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all ATP5L Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human ATP5L (NP_006467.4). MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ATP5L Antibody - Azide and BSA Free

Western Blot: ATP5L AntibodyAzide and BSA Free [NBP2-92577]

Western Blot: ATP5L AntibodyAzide and BSA Free [NBP2-92577]

Western Blot: ATP5L Antibody [NBP2-92577] - Analysis of extracts of various cell lines, using ATP5L at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.
ATP5L Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: ATP5L Antibody - Azide and BSA Free [NBP2-92577] -

Immunocytochemistry/ Immunofluorescence: ATP5L Antibody - Azide and BSA Free [NBP2-92577] - Immunofluorescence analysis of PC-12 cells using ATP5L Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ATP5L Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: ATP5L Antibody - Azide and BSA Free [NBP2-92577] -

Immunocytochemistry/ Immunofluorescence: ATP5L Antibody - Azide and BSA Free [NBP2-92577] - Immunofluorescence analysis of MCF7 cells using ATP5L Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ATP5L Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: ATP5L Antibody - Azide and BSA Free [NBP2-92577] -

Immunocytochemistry/ Immunofluorescence: ATP5L Antibody - Azide and BSA Free [NBP2-92577] - Immunofluorescence analysis of NIH/3T3 cells using ATP5L Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ATP5L Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: ATP5L Antibody - Azide and BSA Free [NBP2-92577] -

Immunocytochemistry/ Immunofluorescence: ATP5L Antibody - Azide and BSA Free [NBP2-92577] - Immunofluorescence analysis of HeLa cells using ATP5L Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for ATP5L Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ATP5L

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, F0, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The F0 seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the g subunit of the F0 complex. (provided by RefSeq)

Alternate Names

ATP synthase subunit g, mitochondrial, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit G, ATP5JG

Gene Symbol

ATP5MG

Additional ATP5L Products

Product Documents for ATP5L Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ATP5L Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for ATP5L Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ATP5L Antibody - Azide and BSA Free and earn rewards!

Have you used ATP5L Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies