ATP5S Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84483

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ATP5S Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ATP5S. Peptide sequence: LRCGAMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHM The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ATP5S Antibody - BSA Free

Western Blot: ATP5S Antibody [NBP2-84483]

Western Blot: ATP5S Antibody [NBP2-84483]

Western Blot: ATP5S Antibody [NBP2-84483] - Host: Rabbit. Target Name: ATP5S. Sample Type: ACHN Whole cell lysates. Antibody Dilution: 1.0ug/ml

Applications for ATP5S Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP5S

The ATP5S gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis,utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATPsynthase is composed of two linke

Alternate Names

ATP synthase coupling factor B-like 1, ATP synthase subunit s, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit s (factor B), ATP synthase, H+ transporting, mitochondrial Fo complex, subunit s (factor B), ATP synthase-coupling factor B, ATPWATP synthase coupling factor B, mitochondrial, HSU79253, Mitochondrial ATP synthase regulatory component factor B

Gene Symbol

ATP5S

Additional ATP5S Products

Product Documents for ATP5S Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATP5S Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATP5S Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATP5S Antibody - BSA Free and earn rewards!

Have you used ATP5S Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies