ATP6V0A4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87055

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ATP6V0A4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ATP6V0A4. Peptide sequence: ADATRIKRALEQGMELSGSSMAPIMTTVQSKTAPPTFNRTNKFTAGFQNI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ATP6V0A4 Antibody - BSA Free

Western Blot: ATP6V0A4 Antibody [NBP2-87055]

Western Blot: ATP6V0A4 Antibody [NBP2-87055]

Western Blot: ATP6V0A4 Antibody [NBP2-87055] - Host: Rabbit. Target Name: ATP6V0A4. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for ATP6V0A4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP6V0A4

The ATP6V0A4 gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sor

Alternate Names

A4, ATP6N2, ATP6V0, ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 1B, ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 2 (38kD), ATPase, H+ transporting, lysosomal V0 subunit a4, MGC130016, MGC130017, noncatalytic accessory protein 1B, RDRTA2, RTA1C, RTADR, STV1, vacuolar proton pump 116 kDa accessory subunit, vacuolar proton pump, subunit 2, vacuolar proton translocating ATPase 116 kDa subunit a kidney isoform, V-ATPase 116 kDa, VPH1, VPP2, V-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 4

Gene Symbol

ATP6V0A4

Additional ATP6V0A4 Products

Product Documents for ATP6V0A4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATP6V0A4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATP6V0A4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATP6V0A4 Antibody - BSA Free and earn rewards!

Have you used ATP6V0A4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies