ATP6V0E2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83944

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ATP6V0E2. Peptide sequence: GPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ATP6V0E2 Antibody - BSA Free

Western Blot: ATP6V0E2 Antibody [NBP2-83944]

Western Blot: ATP6V0E2 Antibody [NBP2-83944]

Western Blot: ATP6V0E2 Antibody [NBP2-83944] - Host: Rabbit. Target Name: ATP6V0E2. Sample Type: Placenta lysates. Antibody Dilution: 1.0ug/ml

Applications for ATP6V0E2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP6V0E2

Multisubunit vacuolar-type proton pumps, or H(+)-ATPases, acidify various intracellular compartments, such as vacuoles,clathrin-coated and synaptic vesicles, endosomes, lysosomes, and chromaffin granules. H(+)-ATPases are also found inplasma membranes of specialized cells, where they play roles in urinary acidification, bone resorption, and spermmaturation. Multiple subunits form H(+)-ATPases, with proteins of the V1 class hydrolyzing ATP for energy to transportH+, and proteins of the V0 class forming an integral membrane domain through which H+ is transported. ATP6V0E2 encodesan isoform of the H(+)-ATPase V0 e subunit, an essential proton pump component (Blake-Palmer et al., 2007 (PubMed17350184)).(supplied by OMIM)

Alternate Names

ATP6V0, ATPase, H+ transporting V0 subunit e2, chromosome 7 open reading frame 32, H+ transporting V0 subunit E isoform 2-like (rat), Lysosomal 9 kDa H(+)-transporting ATPase V0 subunit e2

Gene Symbol

ATP6V0E2

Additional ATP6V0E2 Products

Product Documents for ATP6V0E2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATP6V0E2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATP6V0E2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATP6V0E2 Antibody - BSA Free and earn rewards!

Have you used ATP6V0E2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...