Axotrophin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-76664

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Axotrophin Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N-terminal region of human MARCH7 (membrane-associated ring finger (C3HC4) 7) The peptide sequence was selected from the following region: LSARMMSGSRGSSLNDTYHSRDSSFRLDSEYQSTSASASASPFQSAWYSE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

69 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Axotrophin Antibody - BSA Free

Western Blot: Axotrophin Antibody [NBP2-76664]

Western Blot: Axotrophin Antibody [NBP2-76664]

Western Blot: Axotrophin Antibody [NBP2-76664] - Host: Rabbit. Target Name: MARCH7. Sample Type: Uterus Tumor lysates. Antibody Dilution: 1.0ug/ml
Western Blot: Axotrophin Antibody [NBP2-76664]

Western Blot: Axotrophin Antibody [NBP2-76664]

Western Blot: Axotrophin Antibody [NBP2-76664] - Human uterus tumor lysate. Antibody dilution: 1ug/ml.

Applications for Axotrophin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Axotrophin

MARCH7 is an E3 ubiquitin-protein ligase which may specifically enhance the E2 activity of HIP2. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.

Alternate Names

AXO, AXOT, Axotrophin, E3 ubiquitin-protein ligase MARCH7, EC 6.3.2, EC 6.3.2.-, MARCH-VIIDKFZp586F1122, membrane-associated ring finger (C3HC4) 7, Membrane-associated RING finger protein 7, Membrane-associated RING-CH protein VII, RING finger protein 177, RNF177axotrophin

Gene Symbol

MARCH7

UniProt

F5H6W4 (Human)

Additional Axotrophin Products

Product Documents for Axotrophin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Axotrophin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Axotrophin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Axotrophin Antibody - BSA Free and earn rewards!

Have you used Axotrophin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies