B9D2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84490

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all B9D2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human B9D2. Peptide sequence: SESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for B9D2 Antibody - BSA Free

Western Blot: B9D2 Antibody [NBP2-84490]

Western Blot: B9D2 Antibody [NBP2-84490]

Western Blot: B9D2 Antibody [NBP2-84490] - Host: Rabbit. Target Name: B9D2. Sample Type: Fetal Brain lysates. Antibody Dilution: 1.0ug/ml

Applications for B9D2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: B9D2

The B9D2 gene encodes a B9 domain protein, which are exclusively found in ciliated organisms. The gene is upregulatedduring mucociliary differentiation, and the encoded protein localizes to basal bodies and cilia. Disrupting expressionof this gene results in

Alternate Names

B9 domain-containing protein 2, B9 protein domain 2, ICIS-1, involved in cIlia stability-1, MGC4093, MKS1-related protein 2, MKSR2

Gene Symbol

B9D2

Additional B9D2 Products

Product Documents for B9D2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for B9D2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for B9D2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review B9D2 Antibody - BSA Free and earn rewards!

Have you used B9D2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies