BACH1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55113

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all BACH1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIIS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BACH1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: BACH1 Antibody [NBP2-55113]

Immunocytochemistry/ Immunofluorescence: BACH1 Antibody [NBP2-55113]

Immunocytochemistry/Immunofluorescence: BACH1 Antibody [NBP2-55113] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
BACH1 Antibody

Immunohistochemistry-Paraffin: BACH1 Antibody [NBP2-55113] -

Immunohistochemistry-Paraffin: BACH1 Antibody [NBP2-55113] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.
BACH1 Antibody

Immunohistochemistry-Paraffin: BACH1 Antibody [NBP2-55113] -

Immunohistochemistry-Paraffin: BACH1 Antibody [NBP2-55113] -Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.
BACH1 Antibody

Immunohistochemistry-Paraffin: BACH1 Antibody [NBP2-55113] -

Immunohistochemistry-Paraffin: BACH1 Antibody [NBP2-55113] - Staining of human tonsil shows moderate nuclear positivity in germinal center cells.
BACH1 Antibody

Immunohistochemistry-Paraffin: BACH1 Antibody [NBP2-55113] -

Immunohistochemistry-Paraffin: BACH1 Antibody [NBP2-55113] -Staining of human pancreas shows no positivity in exocrine glandular cells.
BACH1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: BACH1 Antibody - BSA Free [NBP2-55113]

Chromatin Immunoprecipitation-exo-Seq: BACH1 Antibody - BSA Free [NBP2-55113]

ChIP-Exo-Seq composite graph for Anti-BACH1 (NBP2-55113) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for BACH1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC Retrieval method: HIER pH6.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BACH1

BACH1 (also known as BRCA1 interacting protein C-terminal helicase 1, BRCA1-interacting protein 1 and BRCA1-associated C-terminal helicase 1) is a member of the RecQ DEAH helicase family and interacts with the BRCT repeats of breast cancer, type 1 (BRCA1). The bound complex is important in the normal double-strand break repair function of breast cancer, type 1 (BRCA1). The BACH1 gene may be a target of germline cancer-inducing mutations. BACH1 is localized within the nucleus and functions as a DNA-dependent ATPase and 5' to 3' DNA helicase. Two isoforms have been identified for this protein.

Long Name

BTB and CNC homolog 1

Alternate Names

BTB, HA2303

Gene Symbol

BACH1

Additional BACH1 Products

Product Documents for BACH1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BACH1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for BACH1 Antibody - BSA Free

Customer Reviews for BACH1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BACH1 Antibody - BSA Free and earn rewards!

Have you used BACH1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies