BarX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84496

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human BarX2. Peptide sequence: HCHAELRLSSPGQLKAARRRYKTFMIDEILSKETCDYFEKLSLYSVCPSL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for BarX2 Antibody - BSA Free

Western Blot: BarX2 Antibody [NBP2-84496]

Western Blot: BarX2 Antibody [NBP2-84496]

Western Blot: BarX2 Antibody [NBP2-84496] - Host: Rabbit. Target: BARX2. Positive control (+): MCF7 Cell Lysate (N10). Negative control (-): HeLa Cell Lysate (HL). Antibody concentration: 1ug/ml
Western Blot: BarX2 Antibody [NBP2-84496]

Western Blot: BarX2 Antibody [NBP2-84496]

Western Blot: BarX2 Antibody [NBP2-84496] - WB Suggested Anti-BARX2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Muscle
Western Blot: BarX2 Antibody [NBP2-84496]

Western Blot: BarX2 Antibody [NBP2-84496]

Western Blot: BarX2 Antibody [NBP2-84496] - Host: Rabbit. Target Name: BARX2. Sample Tissue: Human U937 Whole Cell. Antibody Dilution: 1ug/ml

Applications for BarX2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BarX2

BARX2 is a member of the Bar class of homeodomain transcription factors. It binds optimally to the DNA consensus sequence YYTAATGRTTTTY. It may control the expression of neural adhesion molecules such as L1 or Ng-CAM during embryonic development of both the central and peripherical nervous system. It may be involved in controlling adhesive processes in keratinizing epithelia. It is highly expressed in adult salivary gland and at much lower levels in mammary gland, kidney and placenta. It contains 1 homeobox DNA-binding domain. BarX2 is a tumour suppressor gene that encodes for a transcription factor known to regulate transcription of cell adhesion molecules in the mouse.

Alternate Names

BarH-like homeobox 2, BARX homeobox 2, homeobox protein BarH-like 2, MGC133368, MGC133369

Gene Symbol

BARX2

Additional BarX2 Products

Product Documents for BarX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BarX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BarX2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BarX2 Antibody - BSA Free and earn rewards!

Have you used BarX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...