Bcl-2 related protein A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10872

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Bcl-2 related protein A1 (NP_004040). Peptide sequence FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Bcl-2 related protein A1 Antibody - BSA Free

Western Blot: Bcl-2 related protein A1 Antibody [NBP3-10872]

Western Blot: Bcl-2 related protein A1 Antibody [NBP3-10872]

Western Blot: Bcl-2 related protein A1 Antibody [NBP3-10872] - Western blot analysis of Bcl-2 related protein A1 in Jurkat cell lysate as a positive control. Antibody dilution at 0.2-1 ug/ml

Applications for Bcl-2 related protein A1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Bcl-2 related protein A1

Bcl-2 related protein A1; also known as Bcl2A1 and Bfl1, is an anti-apoptotic Bcl-2 family member preferentially expressed in hematopoietic and endothelial cells (1). Bfl1 is involved in a variety of cellular activities such as embryonic development, homeostatis and tumorigenesis. Expression of Bfl1 is stimulated by NF-kB in response to inflammatory stimuli and is up-regulated by TNF-alpha, IL1-beta, IGF1, GMC-SF, CD40 and phorbol ester (2-3). Blf1 has also been shown to reduce the release of pro-apoptotic cytochrome c from the mitochondria, block caspase activation and suppress apoptosis induced by p53 (4-5).

Alternate Names

BCL2A1, Bcl2L5, Bfl-1, GRS

Gene Symbol

BCL2A1

Additional Bcl-2 related protein A1 Products

Product Documents for Bcl-2 related protein A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Bcl-2 related protein A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Bcl-2 related protein A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Bcl-2 related protein A1 Antibody - BSA Free and earn rewards!

Have you used Bcl-2 related protein A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...