beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59863

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to B4GALT2(UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2) The peptide sequence was selected from the middle region of B4GALT2. Peptide sequence RLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody - BSA Free

Western Blot: beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody [NBP1-59863]

Western Blot: beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody [NBP1-59863]

Western Blot: beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody [NBP1-59863] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Applications for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: beta-1,4-Galactosyltransferase 2/B4GalT2

This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene synthesizes N-acetyllactosamine in glycolipids and glycoproteins. Its substrate specificity is affected by alpha-lactalbumin but it is not expressed in lactating mammary tissue. Two transcript variants encoding the same protein have been found for this gene.

Long Name

UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, Polypeptide 2

Alternate Names

beta-1,4-Galactosyltransferase 2, Beta-1,4-GalTase 2

Gene Symbol

B4GALT2

UniProt

Additional beta-1,4-Galactosyltransferase 2/B4GalT2 Products

Product Documents for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody - BSA Free and earn rewards!

Have you used beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...