beta-Defensin 4/2 Antibody (4C4) - Azide and BSA Free

Novus Biologicals | Catalog # H00001673-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 4C4

Format

Azide and BSA Free
View all beta-Defensin 2 Primary Antibodies »

Product Specifications

Immunogen

DEFB4 (NP_004933, 24 a.a. ~ 64 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Specificity

DEFB4 (4C4)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for beta-Defensin 4/2 Antibody (4C4) - Azide and BSA Free

Western Blot: beta-Defensin 4/2 Antibody (4C4) [H00001673-M01]

Western Blot: beta-Defensin 4/2 Antibody (4C4) [H00001673-M01]

Western Blot: beta-Defensin 4/2 Antibody (4C4) [H00001673-M01] - Analysis of DEFB4 expression in transfected 293T cell line by DEFB4 monoclonal antibody (M01), clone 4C4.Lane 1: DEFB4 transfected lysate(7.038 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: beta-Defensin 4/2 Antibody (4C4) [H00001673-M01] - Detection limit for recombinant GST tagged DEFB4 is approximately 3ng/ml as a capture antibody.

Applications for beta-Defensin 4/2 Antibody (4C4) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: beta-Defensin 2

Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation.

Long Name

Defensin 2 beta

Alternate Names

BD-2, betaDefensin 2, DEFB2, DEFB4A, DEFB4B, HBD-2, SAP-1

Entrez Gene IDs

1673 (Human)

Gene Symbol

DEFB4A

OMIM

602215 (Human)

UniProt

NP_004933 (Human)

Additional beta-Defensin 2 Products

Product Documents for beta-Defensin 4/2 Antibody (4C4) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for beta-Defensin 4/2 Antibody (4C4) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for beta-Defensin 4/2 Antibody (4C4) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review beta-Defensin 4/2 Antibody (4C4) - Azide and BSA Free and earn rewards!

Have you used beta-Defensin 4/2 Antibody (4C4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies