beta-Synuclein Antibody (4F11) - Azide and BSA Free

Novus Biologicals | Catalog # H00006620-M16

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4F11

Format

Azide and BSA Free
View all beta-Synuclein Primary Antibodies »

Product Specifications

Immunogen

SNCB (NP_001001502.1, 1 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASH

Specificity

SNCB - synuclein, beta (4F11)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for beta-Synuclein Antibody (4F11) - Azide and BSA Free

ELISA: beta-Synuclein Antibody (4F11) [H00006620-M16]

ELISA: beta-Synuclein Antibody (4F11) [H00006620-M16]

ELISA: Synuclein-beta Antibody (4F11) [H00006620-M16] - Detection limit for recombinant GST tagged SNCB is approximately 1ng/ml as a capture antibody.

Applications for beta-Synuclein Antibody (4F11) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: beta-Synuclein

The protein encoded by this gene is highly homologous to alpha-synuclein. These proteins are abundantly expressed in the brain and putatively inhibit phospholipase D2 selectively. The encoded protein, which may play a role in neuronal plasticity, is abundant in neurofibrillary lesions of patients with Alzheimer disease. This protein has been shown to be highly expressed in the substantia nigra of the brain, a region of neuronal degeneration in patients with Parkinson disease; however, no direct relation to Parkinson disease has been established. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Alternate Names

SNCB, Synuclein-beta

Entrez Gene IDs

6620 (Human)

Gene Symbol

SNCB

UniProt

NP_001001502 (Human)

Additional beta-Synuclein Products

Product Documents for beta-Synuclein Antibody (4F11) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for beta-Synuclein Antibody (4F11) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for beta-Synuclein Antibody (4F11) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review beta-Synuclein Antibody (4F11) - Azide and BSA Free and earn rewards!

Have you used beta-Synuclein Antibody (4F11) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies