BHLHB5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10296

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all BHLHB5 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BHLHB5 (NP_689627). Peptide sequence LPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPR

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for BHLHB5 Antibody - BSA Free

Western Blot: BHLHB5 Antibody [NBP3-10296]

Western Blot: BHLHB5 Antibody [NBP3-10296]

Western Blot: BHLHB5 Antibody [NBP3-10296] - Western blot analysis using NBP3-10296 on Human Jurkat as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for BHLHB5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BHLHB5

Alternate Names

Basic Helix-Loop-Helix Domain Containing, Class B, 5, basic helix-loop-helix family, member e22, Beta3, BHLHE22, CAGL85, Class B Basic Helix-Loop-Helix Protein 5, Class E Basic Helix-Loop-Helix Protein 22, TNRC20, Trinucleotide Repeat Containing 20, Trinucleotide Repeat-Containing Gene 20 Protein

Gene Symbol

BHLHE22

Additional BHLHB5 Products

Product Documents for BHLHB5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BHLHB5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BHLHB5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BHLHB5 Antibody - BSA Free and earn rewards!

Have you used BHLHB5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies