BLAP75 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58133

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to RMI1(RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of RMI1 (NP_079221). Peptide sequence DGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for BLAP75 Antibody - BSA Free

Western Blot: BLAP75 Antibody [NBP1-58133]

Western Blot: BLAP75 Antibody [NBP1-58133]

Western Blot: BLAP75 Antibody [NBP1-58133] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Applications for BLAP75 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BLAP75

RMI1 is an essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates to limit DNA crossover formation in cells. RMI1 promotes TOP3A binding to double Holliday junctions (DHJ) and hence stimulates TOP3A-mediated dissolution. RMI1 is required for BLM phosphorylation during mitosis. Within the BLM complex, RMI1 is required for BLM and TOP3A stability.RMI1 is a component of protein complexes that limit DNA crossover formation via the dissolution of double Holliday junctions (Raynard et al., 2006 [PubMed 16595695]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-136 BP327553.1 1-136 137-885 DN997105.1 9-757 886-2740 AL732446.4 14777-16631 2741-3508 BC039999.2 2566-3333

Alternate Names

75 kDa, BLM-associated protein 75 kDa, BLM-associated protein of 75 kDa, chromosome 9 open reading frame 76, FAAP75, FLJ12888, homolog of yeast RecQ-mediated genome instability 1 (RMI1), recQ-mediated genome instability protein 1, RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae), RMI2

Entrez Gene IDs

80010 (Human)

Gene Symbol

RMI1

UniProt

Additional BLAP75 Products

Product Documents for BLAP75 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BLAP75 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for BLAP75 Antibody - BSA Free

Customer Reviews for BLAP75 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BLAP75 Antibody - BSA Free and earn rewards!

Have you used BLAP75 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...