Blk Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-68887

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Blk Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: YTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLEMERWF

Reactivity Notes

Mouse 84%, Rat 86%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Blk Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Blk Antibody [NBP2-68887]

Immunocytochemistry/ Immunofluorescence: Blk Antibody [NBP2-68887]

Immunocytochemistry/Immunofluorescence: Blk Antibody [NBP2-68887] - Staining of human cell line REH shows localization to nucleoplasm.

Applications for Blk Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Blk

BLK ( B lymphoid tyrosine kinase), with 505-amino acid protein (about 56KDa), belongs to the Src non-receptor tyrosine kinases family.Different subcellular localizations of Src-family kinases may be important for the regulation of specific cellular processes such as mitogenesis, cytoskeletal organization, and membrane trafficking.Blk is expressed exclusively by B lymphocytes and it is thought to function in a signal transductory pathway specific to this lineage. B lymphoid expression of an active Blk mutant caused proliferation of B progenitor cells and enhanced responsiveness of these cells to interleukin 7. Thus, sustained activation of Blk induces responses normally associated with the pre-BCR.

Long Name

B Lymphoid Tyrosine Kinase

Alternate Names

B lymphocyte kinase, B lymphoid tyrosine kinase, BLK nonreceptor tyrosine kinase, EC 2.7.10.2, MGC10442, MODY11, p55-Blk, tyrosine-protein kinase Blk

Gene Symbol

BLK

Additional Blk Products

Product Documents for Blk Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Blk Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

B Cell Activation
Intracellular Kinases

Customer Reviews for Blk Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Blk Antibody - BSA Free and earn rewards!

Have you used Blk Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies