Blood Group B Transferase/GTB/ABO Antibody (1B7) - Azide and BSA Free

Novus Biologicals | Catalog # H00000028-M08

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1B7

Format

Azide and BSA Free
View all Blood Group B Transferase/GTB Primary Antibodies »

Product Specifications

Immunogen

ABO (NP_065202.2, 273 a.a. ~ 354 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP

Specificity

This product is specific for Human ABO monoclonal antibody (M08), clone 1B7 [Gene ID: 28].

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Blood Group B Transferase/GTB/ABO Antibody (1B7) - Azide and BSA Free

Western Blot: Blood Group B Transferase/GTB/ABO Antibody (1B7) [H00000028-M08]

Western Blot: Blood Group B Transferase/GTB/ABO Antibody (1B7) [H00000028-M08]

Western Blot: Blood Group B Transferase/GTB/ABO Antibody (1B7) [H00000028-M08] - Analysis of ABO expression in A-431.
ELISA: Blood Group B Transferase/GTB/ABO Antibody (1B7) [H00000028-M08]

ELISA: Blood Group B Transferase/GTB/ABO Antibody (1B7) [H00000028-M08]

ELISA: Blood Group B Transferase/GTB/ABO Antibody (1B7) [H00000028-M08] - Detection limit for recombinant GST tagged ABO is 0.3 ng/ml as a capture antibody.

Applications for Blood Group B Transferase/GTB/ABO Antibody (1B7) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Blood Group B Transferase/GTB

The ABO gene encodes proteins related to the first discovered blood group system, ABO. Which allele is present in anindividual determines the blood group. The 'O' blood group is caused by a deletion of guanine-258 near theN-terminus of the protein which resu

Long Name

Fucosylglycoprotein 3-alpha-galactosyltransferase

Alternate Names

A3GALT1, ABO

Gene Symbol

ABO

UniProt

NP_065202.2 (Human)

Additional Blood Group B Transferase/GTB Products

Product Documents for Blood Group B Transferase/GTB/ABO Antibody (1B7) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Blood Group B Transferase/GTB/ABO Antibody (1B7) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Glycobiology-related Enzymes

Customer Reviews for Blood Group B Transferase/GTB/ABO Antibody (1B7) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Blood Group B Transferase/GTB/ABO Antibody (1B7) - Azide and BSA Free and earn rewards!

Have you used Blood Group B Transferase/GTB/ABO Antibody (1B7) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies