Bradykinin RB2/BDKRB2 Antibody (3F6) - Azide and BSA Free

Novus Biologicals | Catalog # H00000624-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Flow Cytometry, Functional

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 Lambda Clone # 3F6

Format

Azide and BSA Free
View all Bradykinin RB2/BDKRB2 Primary Antibodies »

Product Specifications

Immunogen

BDKRB2 (NP_000614, 1 a.a. ~ 60 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ

Specificity

BDKRB2 - bradykinin receptor B2

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 Lambda

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Bradykinin RB2/BDKRB2 Antibody (3F6) - Azide and BSA Free

ELISA: Bradykinin RB2/BDKRB2 Antibody (3F6) [H00000624-M01]

ELISA: Bradykinin RB2/BDKRB2 Antibody (3F6) [H00000624-M01]

ELISA: Bradykinin RB2/BDKRB2 Antibody (3F6) [H00000624-M01] - Detection limit for recombinant GST tagged BDKRB2 is approximately 0.1ng/ml as a capture antibody.

Applications for Bradykinin RB2/BDKRB2 Antibody (3F6) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Flow Cytometry Panel Builder

Bio-Techne Knows Flow Cytometry

Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.

Advanced Features

  • Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
  • Spillover Popups - Visualize the spectra of individual fluorochromes
  • Antigen Density Selector - Match fluorochrome brightness with antigen density
Build Your Panel Now
Flow Cytometry

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Bradykinin RB2/BDKRB2

This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.

Long Name

Bradykinin Receptor B2

Alternate Names

B2R, BDKRB2, BKR2, BradykininRB2, BRB2

Entrez Gene IDs

624 (Human)

Gene Symbol

BDKRB2

OMIM

113503 (Human)

UniProt

NP_000614

Additional Bradykinin RB2/BDKRB2 Products

Product Documents for Bradykinin RB2/BDKRB2 Antibody (3F6) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Bradykinin RB2/BDKRB2 Antibody (3F6) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Bradykinin RB2/BDKRB2 Antibody (3F6) - Azide and BSA Free

Customer Reviews for Bradykinin RB2/BDKRB2 Antibody (3F6) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Bradykinin RB2/BDKRB2 Antibody (3F6) - Azide and BSA Free and earn rewards!

Have you used Bradykinin RB2/BDKRB2 Antibody (3F6) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies