BRD7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92408

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human

Applications

Knockout Validated, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all BRD7 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human BRD7 (NP_037395.2). MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKDRKRKKRKKGEKQIPGEEKGRKRRRVKEDKKKRDRD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Knockout (KO) Validated Rabbit BRD7 Antibody - BSA Free (NBP2-92408) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for BRD7 Antibody - BSA Free

Western Blot: BRD7 AntibodyBSA Free [NBP2-92408]

Western Blot: BRD7 AntibodyBSA Free [NBP2-92408]

Western Blot: BRD7 Antibody [NBP2-92408] - Western blot analysis of extracts from normal (control) and BRD7 Rabbit pAb knockout (KO) 293T cells, using BRD7 Rabbit pAb antibody (NBP2-92408) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Western Blot: BRD7 AntibodyBSA Free [NBP2-92408]

Western Blot: BRD7 AntibodyBSA Free [NBP2-92408]

Western Blot: BRD7 Antibody [NBP2-92408] - Analysis of extracts of various cell lines, using BRD7 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

Applications for BRD7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: BRD7

Bromodomain-containing protein 7 was identified in a two-hybrid screen as an interactor of interferon regulatory factor-2 (IRF-2) and called CELTIX1. BRD7 was also identified as a binding partner of disheveled-1 (Dvl-1) and found to play a role in Wnt signaling and the regulation of glycogen synthase kinase 3-beta activity. Recently, BRD7 was identified as a subunit of the polybromo-associated BRG1-associated factor (PBAF) complex and shown to be required for the modulation of transcription in embryonic stem cells.

Long Name

Bromodomain Containing 7

Alternate Names

BP75, CELTIX1, NAG4

Gene Symbol

BRD7

Additional BRD7 Products

Product Documents for BRD7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BRD7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Epigenetics

Customer Reviews for BRD7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BRD7 Antibody - BSA Free and earn rewards!

Have you used BRD7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies