BRF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55335

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all BRF1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAKDGSTEDTASSLCGEEDTEDEELEAAASHLNKDL

Reactivity Notes

Mouse (88%), Rat (87%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BRF1 Antibody - BSA Free

Western Blot: BRF1 Antibody [NBP2-55335]

Western Blot: BRF1 Antibody [NBP2-55335]

Western Blot: BRF1 Antibody [NBP2-55335] - Analysis in human cell line SCLC-21H.
Immunocytochemistry/ Immunofluorescence: BRF1 Antibody [NBP2-55335]

Immunocytochemistry/ Immunofluorescence: BRF1 Antibody [NBP2-55335]

Immunocytochemistry/Immunofluorescence: BRF1 Antibody [NBP2-55335] - Staining of human cell line MCF7 shows localization to nucleoplasm & nuclear bodies.
BRF1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: BRF1 Antibody - BSA Free [NBP2-55335]

Chromatin Immunoprecipitation-exo-Seq: BRF1 Antibody - BSA Free [NBP2-55335]

ChIP-Exo-Seq composite graph for Anti-BRF1 (NBP2-55335) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for BRF1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BRF1

BRF1 encodes one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs. The gene product belongs to the TF2B family. Two alternatively spliced variants encoding different isoforms, that function at different promoters transcribed by RNA polymerase III, have been identified. Other transcript variants are possible, but their full-length natures have not been completely characterized.

Alternate Names

B-related factor 1, BRF-1, BRF1 homolog, subunit of RNA polymerase III transcription initiation factorIIIB (S. cerevisiae), BRFFLJ42674, general transcription factor IIIB, 90kD subunit, GTF3BTAFIII90, hBRFMGC105048, hTFIIIB90, TAF3B2, TAF3CB - related factor 1, TATA box binding protein (TBP)-associated factor 3C, TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3Bsubunit 2, TATA box binding protein (TBP)-associated factor, RNA polymerase III, subunit 2, TATA box-binding protein-associated factor, RNA polymerase III, subunit 2, TBP - associated factor, RNA polymerase III, 90kD, TF3B90, TFIIIB90FLJ43034, transcription factor IIIB 90 kDa subunit

Gene Symbol

BRF1

Additional BRF1 Products

Product Documents for BRF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BRF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for BRF1 Antibody - BSA Free

Customer Reviews for BRF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BRF1 Antibody - BSA Free and earn rewards!

Have you used BRF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies