BRSK2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86587

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all BRSK2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human BRSK2. Peptide sequence: EEENQEKMIYFLLLDRKERYPSQEDEDLPPRNEIDPPRKRVDSPMLNRHG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for BRSK2 Antibody - BSA Free

Western Blot: BRSK2 Antibody [NBP2-86587]

Western Blot: BRSK2 Antibody [NBP2-86587]

Western Blot: BRSK2 Antibody [NBP2-86587] - Host: Rabbit. Target Name: BRSK2. Sample Type: HT1080 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for BRSK2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BRSK2

BRSK2 (BR serine/threonine-protein kinase 2) is required for the polarization of forebrain neurons which endows axons and dendrites with distinct properties, possibly by locally regulating phosphorylation of microtubule-associated proteins. This enyme is activated by phosphorylation on Thr-174 by STK11 in complex with STE20-related adapter-alpha (STRAD alpha) pseudo kinase and CAB39.

Alternate Names

BR serine/threonine kinase 2, BR serine/threonine-protein kinase 2, C11orf7, chromsosome 11 open reading frame 7, EC 2.7.11, EC 2.7.11.1, FLJ41362, PEN11BSAD1, protein kinase SAD1B, serine/threonine kinase 29, serine/threonine kinase SAD-A, Serine/threonine-protein kinase 29, Serine/threonine-protein kinase SAD-A, STK29

Gene Symbol

BRSK2

Additional BRSK2 Products

Product Documents for BRSK2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BRSK2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BRSK2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BRSK2 Antibody - BSA Free and earn rewards!

Have you used BRSK2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies