BRUNOL6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57256

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all BRUNOL6 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to BRUNOL6(bruno-like 6, RNA binding protein (Drosophila)) The peptide sequence was selected from the middle region of BRUNOL6. Peptide sequence QAALLAAAQGPGLGPVAAVAAQMQHVAAFSLVAAPLLPAAAANSPPGSGP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for BRUNOL6 Antibody - BSA Free

Western Blot: BRUNOL6 Antibody [NBP1-57256]

Western Blot: BRUNOL6 Antibody [NBP1-57256]

Western Blot: BRUNOL6 Antibody [NBP1-57256] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for BRUNOL6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BRUNOL6

BRUNOL6 is a RNA-binding protein implicated in the regulation of pre-mRNA alternative splicing. It mediates exon inclusion and/or exclusion in pre-mRNAs that are subject to tissue-specific and developmentally regulated alternative splicing. BRUNOL6 specifically activates exon 5 inclusion of TNNT2 in a muscle-specific splicing enhancer (MSE)-dependent manner. It also promotes exon exclusion of INSR pre-mRNA.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.

Alternate Names

Bruno (Drosophila) -like 6, RNA binding protein, Bruno -like 6, RNA binding protein, BRUNOL6bruno-like 6, RNA binding protein (Drosophila), bruno-like 6, RNA binding protein, Bruno-like protein 6, CELF-6, CUG-BP and ETR-3 like factor 6, CUG-BP- and ETR-3-like factor 6, CUGBP Elav-like family member 6, CUGBP, Elav-like family member 6, RNA-binding protein BRUNOL-6

Gene Symbol

CELF6

UniProt

Q96J87 (Human)

Additional BRUNOL6 Products

Product Documents for BRUNOL6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BRUNOL6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BRUNOL6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BRUNOL6 Antibody - BSA Free and earn rewards!

Have you used BRUNOL6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies