c-Maf Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92085

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all c-Maf Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human c-Maf (NP_005351.2). HVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit c-Maf Antibody - Azide and BSA Free (NBP2-92085) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for c-Maf Antibody - Azide and BSA Free

c-Maf Antibody - Azide and BSA Free

Western Blot: c-Maf Antibody - Azide and BSA Free [NBP2-92085] -

Western Blot: c-Maf Antibody - Azide and BSA Free [NBP2-92085] - Western blot analysis of various lysates using c-Maf Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for c-Maf Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:1000-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: c-Maf

c-Maf is part of the Maf family of transcription factors that possess a conserved basic region and a leucine zipper domain that mediate DNA and protein-protein binding and plays an important role in tissue-specific gene regulation and cell differentiation. c-Maf is a transcriptional activator of interleukin 4 and 10 in T-cells, and is involved in lens fiber cell differentiation. c-Maf translocation has been observed in human multiple myeloma and may be oncogenic.

Long Name

v-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog (Avian)

Alternate Names

CCA4, cMaf, MAF2

Gene Symbol

MAF

Additional c-Maf Products

Product Documents for c-Maf Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for c-Maf Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for c-Maf Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review c-Maf Antibody - Azide and BSA Free and earn rewards!

Have you used c-Maf Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

Th2 Differentiation Pathway Th2 Differentiation Pathway Thumbnail