CABYR Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87110

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CABYR Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CABYR. Peptide sequence: QVACLKENEQSKENEQSPRVSPKSVVEKTTSGMSKKSVESVKLAQLEENA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CABYR Antibody - BSA Free

Western Blot: CABYR Antibody [NBP2-87110]

Western Blot: CABYR Antibody [NBP2-87110]

Western Blot: CABYR Antibody [NBP2-87110] - Host: Rabbit. Target Name: CABYR. Sample Tissue: Human Mesenchymoma Tumor lysates. Antibody Dilution: 1ug/ml

Applications for CABYR Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CABYR

To reach fertilization competence, spermatozoa undergo a series of morphological and molecular maturational processes, termed capacitation, involving protein tyrosine phosphorylation and increased intracellular calcium. The protein encoded by this gene localizes to the principal piece of the sperm flagellum in association with the fibrous sheath and exhibits calcium-binding when phosphorylated during capacitation. A pseudogene on chromosome 3 has been identified for this gene. Transcript variants of this gene encode multiple protein isoforms. An additional transcript and isoform has not been fully characterized. [provided by RefSeq]

Alternate Names

CABYRa, CABYRc, calcium binding tyrosine-(Y)-phosphorylation regulated, Calcium-binding protein 86, calcium-binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2), Cancer/testis antigen 88, CBP86CABYRc/d, CT88MGC9117, fibrousheathin 2, Fibrousheathin II, fibrousheathin-2, FSP-2calcium binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2), FSP2calcium-binding tyrosine phosphorylation-regulated protein, Testis-specific calcium-binding protein CBP86

Gene Symbol

CABYR

Additional CABYR Products

Product Documents for CABYR Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CABYR Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CABYR Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CABYR Antibody - BSA Free and earn rewards!

Have you used CABYR Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies