CACNA2D4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-68992

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to CACNA2D4 (calcium channel, voltage-dependent, alpha 2/delta subunit 4) The peptide sequence was selected from the C terminal of CACNA2D4. Peptide sequence MAFLGTRAGLLRSSLFVGSEKVSDRKFLTPEDEASVFTLDRFPLWYRQAS The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: alpha-2/delta-4.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

128 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CACNA2D4 Antibody - BSA Free

Western Blot: CACNA2D4 Antibody [NBP1-68992]

Western Blot: CACNA2D4 Antibody [NBP1-68992]

Western Blot: CACNA2D4 Antibody [NBP1-68992] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Applications for CACNA2D4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CACNA2D4

This gene encodes a member of the alpha-2/delta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. Research on a highly similar protein in rabbit suggests the protein described in this record is cleaved into alpha-2 and delta subunits. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.

Long Name

Voltage-dependent calcium channel subunit alpha-2/delta-4

Alternate Names

calcium channel, voltage-dependent, alpha 2/delta subunit 4, RCD4, voltage-dependent calcium channel subunit alpha-2/delta-4, voltage-gated calcium channel alpha(2)delta-4 subunit, Voltage-gated calcium channel subunit alpha-2/delta-4

Gene Symbol

CACNA2D4

UniProt

Additional CACNA2D4 Products

Product Documents for CACNA2D4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CACNA2D4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CACNA2D4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CACNA2D4 Antibody - BSA Free and earn rewards!

Have you used CACNA2D4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...