Cadherin-12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59225

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to CDH12(cadherin 12, type 2 (N-cadherin 2)) The peptide sequence was selected from the middle region of CDH12. Peptide sequence DTQEGVIKLKKPLDFETKKAYTFKVEASNLHLDHRFHSAGPFKDTATVKI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Cadherin-12 Antibody - BSA Free

Western Blot: Cadherin-12 Antibody [NBP1-59225]

Western Blot: Cadherin-12 Antibody [NBP1-59225]

Western Blot: Cadherin-12 Antibody [NBP1-59225] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 312500 Positive control: 721_B cell lysate CDH12 is supported by BioGPS gene expression data to be expressed in 721_B.
Western Blot: Cadherin-12 Antibody [NBP1-59225]

Western Blot: Cadherin-12 Antibody [NBP1-59225]

Western Blot: Cadherin-12 Antibody [NBP1-59225] - WB assay of 721 B cell lysate with Cadherin-12 Antibody

Applications for Cadherin-12 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cadherin-12

CDH12 belongs to the protocadherin protein family, a subfamily of the cadherin superfamily. It consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The function of this cellular adhesion protein is undetermined but mouse protocadherin 12 does not bind catenins and appears to have no affect on cell migration or growth.This gene encodes a type II classical cadherin from the cadherin superfamily of integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. This particular cadherin appears to be expressed specifically in the brain and its temporal pattern of expression would be consistent with a role during a critical period of neuronal development, perhaps specifically during synaptogenesis.

Alternate Names

Br-Cadherin, Cadherin12, CDH12, CDHB, N-Cadherin 2

Gene Symbol

CDH12

UniProt

Additional Cadherin-12 Products

Product Documents for Cadherin-12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cadherin-12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Cadherin-12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cadherin-12 Antibody - BSA Free and earn rewards!

Have you used Cadherin-12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...