Cadherin-8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84583

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Cadherin-8 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human Cadherin-8. Peptide sequence: RLHTDLDPGSKKIKYILSGDGAGTIFQINDVTGDIHAIKRLDREEKAEYT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Cadherin-8 Antibody - BSA Free

Western Blot: Cadherin-8 Antibody [NBP2-84583]

Western Blot: Cadherin-8 Antibody [NBP2-84583]

Western Blot: Cadherin-8 Antibody [NBP2-84583] - Host: Rabbit. Target Name: CDH8. Sample Type: Fetal Stomach lysates. Antibody Dilution: 1.0ug/ml
Western Blot: Cadherin-8 Antibody [NBP2-84583]

Western Blot: Cadherin-8 Antibody [NBP2-84583]

Western Blot: Cadherin-8 Antibody [NBP2-84583] - Host: Rat. Target Name: CDH8. Sample Tissue: Rat Skeletal Muscle. Antibody Dilution: 1ug/ml

Applications for Cadherin-8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cadherin-8

The cadherins are a family of Ca++-dependent adhesion molecules that function to mediate cell-cell binding critical to the maintenance of tissue structure and morphogenesis. Cadherins each contain a large extracellular domain at the amino terminus, which is characterized by a series of five homologous repeats, the most distal of which is thought to be responsible for binding specificity. The relatively short carboxy terminal, intracellular domain interacts with a variety of cytoplasmic proteins, including beta-catenin, to regulate cadherin function. cadherin-8 expression has been seen in mouse thymus tissue as well as in specific subdivisions of the developing central nervous system. It plays a potential role in brain morphology.

Alternate Names

Cadherin8, CDH8

Gene Symbol

CDH8

Additional Cadherin-8 Products

Product Documents for Cadherin-8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cadherin-8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Adhesion Molecules
Cadherin Superfamily

Customer Reviews for Cadherin-8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cadherin-8 Antibody - BSA Free and earn rewards!

Have you used Cadherin-8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies