CALHM1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87116

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CALHM1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of CALHM1. Peptide sequence: GITDQGTMNRLLTSWHKCKPPLRLGQEAPLMSNGWAGGEPRPPRKEVATY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CALHM1 Antibody - BSA Free

Western Blot: CALHM1 Antibody [NBP2-87116]

Western Blot: CALHM1 Antibody [NBP2-87116]

Western Blot: CALHM1 Antibody [NBP2-87116] - WB Suggested Anti-EG546729 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Intestine

Applications for CALHM1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CALHM1

CALHM1 controls cytosolic calcium permeability and cytosolic calcium concentration. It controls amyloid precursor protein (APP) proteolysis and aggregated amyloid-beta (Abeta) peptides levels in a calcium dependent manner. However, no association between CALHM1 and Alzheimer's risk is unclear. Member of the FAM26 family of proteins. CALHM1 is predominantly expressed in the adult brain. It has also been detected in retinoic acid differentiated SH-SY5Y cells. Also colocalizes with HSPA5 at the endoplasmic reticulum.

Alternate Names

calcium homeostasis modulator 1, FAM26Ccalcium homeostasis modulator protein 1, family with sequence similarity 26, member C, MGC39514, MGC39617, Protein FAM26C

Gene Symbol

CALHM1

Additional CALHM1 Products

Product Documents for CALHM1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CALHM1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CALHM1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CALHM1 Antibody - BSA Free and earn rewards!

Have you used CALHM1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies