Calmodulin 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98474

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Calmodulin 3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is Calmodulin 3 - N-terminal region. Peptide sequence LQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Calmodulin 3 Antibody - BSA Free

Western Blot: Calmodulin 3 Antibody [NBP1-98474]

Western Blot: Calmodulin 3 Antibody [NBP1-98474]

Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human MCF7, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in MCF7.
Western Blot: Calmodulin 3 Antibody [NBP1-98474]

Western Blot: Calmodulin 3 Antibody [NBP1-98474]

Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Titration: 1.0 ug/ml Positive Control: Hela Whole Cell.
Western Blot: Calmodulin 3 Antibody [NBP1-98474]

Western Blot: Calmodulin 3 Antibody [NBP1-98474]

Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human 721_B, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Western Blot: Calmodulin 3 Antibody [NBP1-98474]

Western Blot: Calmodulin 3 Antibody [NBP1-98474]

Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human HepG2, Antibody Dilution: 1.0 ug/ml CALM3 is supported by BioGPS gene expression data to be expressed in HepG2.
Western Blot: Calmodulin 3 Antibody [NBP1-98474]

Western Blot: Calmodulin 3 Antibody [NBP1-98474]

Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human Jurkat, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

Applications for Calmodulin 3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Calmodulin 3

Calmodulin 3 belongs to the calmodulin family and is involved in mediating the control of several enzymes, protein kinases, ion channels and phosphatases by Ca(2+). This protein is known to have interactions with CACNA1C, KCNH1, FKBP8, RALA, and RALB.

Alternate Names

CALM, CALM1, CALM2, CALML2, calmodulin, calmodulin 3 (phosphorylase kinase, delta), CAM, CAM1, CAM2, CAM3, CAMB, CAMC, CAMIII, PHKD, PHKD3

Gene Symbol

CALM3

UniProt

EAW57427 (Human)

Additional Calmodulin 3 Products

Product Documents for Calmodulin 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Calmodulin 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Calmodulin 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Calmodulin 3 Antibody - BSA Free and earn rewards!

Have you used Calmodulin 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies