Calsenilin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82380

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Calsenilin Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide towards CSEN. Peptide sequence PMSMEDSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Calsenilin Antibody - BSA Free

Western Blot: Calsenilin Antibody [NBP1-82380]

Western Blot: Calsenilin Antibody [NBP1-82380]

Western Blot: Calsenilin Antibody [NBP1-82380] - Calsenilin Antibody Mouse Pancreas Lysate 1.0 ug/ml, gel concentration 12%

Applications for Calsenilin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Calsenilin

The human prodynorphin gene, which is involved in memory acquisition and pain, is regulated by its downstream regulatory element (DRE). The DRE acts as a location-dependent gene silencer. DREAM is a transcriptional repressor, DRE-antagonist modulator. It is the first known Ca2+ binding protein that binds to DNA and regulates transcription.

Alternate Names

calsenilin, calsenilin, presenilin-binding protein, EF hand transcription factor, CSEN MGC18289, DREAM, DREAMA-type potassium channel modulatory protein 3, KChIP3, KCHIP3 DRE-antagonist modulator, Kv channel interacting protein 3, calsenilin, Kv channel-interacting protein 3, potassium channel interacting protein 3

Gene Symbol

KCNIP3

UniProt

NP_001104801 (Mouse)

Additional Calsenilin Products

Product Documents for Calsenilin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Calsenilin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Calsenilin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Calsenilin Antibody - BSA Free and earn rewards!

Have you used Calsenilin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies