CAP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58320

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to CAP1(CAP, adenylate cyclase-associated protein 1 (yeast)) The peptide sequence was selected from the middle region of CAP1. Peptide sequence KAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQEN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CAP1 Antibody - BSA Free

Western Blot: CAP1 Antibody [NBP1-58320]

Western Blot: CAP1 Antibody [NBP1-58320]

Western Blot: CAP1 Antibody [NBP1-58320] - THP-1 cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: CAP1 Antibody [NBP1-58320]

Immunohistochemistry: CAP1 Antibody [NBP1-58320]

Immunohistochemistry: CAP1 Antibody [NBP1-58320] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Plasma membrane Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
CAP1 Antibody - BSA Free

Western Blot: CAP1 Antibody - BSA Free [NBP1-58320] -

CAP1 is down‐regulated during terminal erythroid differentiation. A, A representative diagram of erythroid populations in E14.5 foetal livers, analysed by flow cytometry with antibodies against CD71 and Ter119. B‐D, R1 to R4 cell populations showed in (A) were sorted by flow cytometry. The mRNA levels of beta ‐globin (B), pri‐miR‐144/451 (C) and Cap1 (D) were then determined by real‐time RT‐PCR assays. 18S (B & D) or U6 (C) rRNAs were used as the internal reference controls. E, Western blotting analyses of CAP1 protein levels in R1 to R4 cell populations. F, Gross view of the cell pellets from D0 and D2 in vitro differentiated foetal liver erythroid cells. G, D0 and D2 in vitro cultured foetal liver cells were stained with APC‐Ter119 and Hoechst 33342. Representative plots of flow cytometry were shown on the left and averaged percentage of Ter119high/Hoechstlow population from 3 independent experiments on the right. H, Relative expression levels of beta ‐globin, pri‐miR‐144/451 and Cap1 from D0 and D2 in vitro cultured foetal liver cells. B‐D, E, G, H, All data are presented as mean +/- SEM from at least three biological replicates (*P <.05; **P <.01; ***P <.001) Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33496386), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for CAP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CAP1

The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin. Alternatively splice

Long Name

CAP, Adenylate Cyclase-Associated Protein 1

Alternate Names

CAP1-PEN

Gene Symbol

CAP1

UniProt

Additional CAP1 Products

Product Documents for CAP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CAP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CAP1 Antibody - BSA Free

Customer Reviews for CAP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CAP1 Antibody - BSA Free and earn rewards!

Have you used CAP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...