CAP1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-58320
Loading...
Key Product Details
Species Reactivity
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to CAP1(CAP, adenylate cyclase-associated protein 1 (yeast)) The peptide sequence was selected from the middle region of CAP1.
Peptide sequence KAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQEN. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for CAP1 Antibody - BSA Free
Western Blot: CAP1 Antibody [NBP1-58320]
Western Blot: CAP1 Antibody [NBP1-58320] - THP-1 cell lysate, concentration 0.2-1 ug/ml.Immunohistochemistry: CAP1 Antibody [NBP1-58320]
Immunohistochemistry: CAP1 Antibody [NBP1-58320] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Plasma membrane Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 secWestern Blot: CAP1 Antibody - BSA Free [NBP1-58320] -
CAP1 is down‐regulated during terminal erythroid differentiation. A, A representative diagram of erythroid populations in E14.5 foetal livers, analysed by flow cytometry with antibodies against CD71 and Ter119. B‐D, R1 to R4 cell populations showed in (A) were sorted by flow cytometry. The mRNA levels of beta ‐globin (B), pri‐miR‐144/451 (C) and Cap1 (D) were then determined by real‐time RT‐PCR assays. 18S (B & D) or U6 (C) rRNAs were used as the internal reference controls. E, Western blotting analyses of CAP1 protein levels in R1 to R4 cell populations. F, Gross view of the cell pellets from D0 and D2 in vitro differentiated foetal liver erythroid cells. G, D0 and D2 in vitro cultured foetal liver cells were stained with APC‐Ter119 and Hoechst 33342. Representative plots of flow cytometry were shown on the left and averaged percentage of Ter119high/Hoechstlow population from 3 independent experiments on the right. H, Relative expression levels of beta ‐globin, pri‐miR‐144/451 and Cap1 from D0 and D2 in vitro cultured foetal liver cells. B‐D, E, G, H, All data are presented as mean +/- SEM from at least three biological replicates (*P <.05; **P <.01; ***P <.001) Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33496386), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for CAP1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CAP1
Long Name
CAP, Adenylate Cyclase-Associated Protein 1
Alternate Names
CAP1-PEN
Gene Symbol
CAP1
UniProt
Additional CAP1 Products
Product Documents for CAP1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CAP1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for CAP1 Antibody - BSA Free
Customer Reviews for CAP1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CAP1 Antibody - BSA Free and earn rewards!
Have you used CAP1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...