Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62370

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to CHST1(carbohydrate (keratan sulfate Gal-6) sulfotransferase 1) The peptide sequence was selected from the middle region of CHST1. Peptide sequence YRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody - BSA Free

Western Blot: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62370]

Western Blot: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62370]

Western Blot: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62370] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62370]

Western Blot: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62370]

Western Blot: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62370] - Human kidney lysate, concentration 0.2-1 ug/ml.
Western Blot: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62370]

Western Blot: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62370]

Western Blot: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62370] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Applications for Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carbohydrate Sulfotransferase 1/CHST1

CHST1 catalyzes the transfer of sulfate to position 6 of galactose (Gal) residues of keratan. It has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer. The sulfotransferase activity on sialyl LacNAc struct

Alternate Names

6-O-sulfotransferase 1, CHST1, GST-1, KS6ST, KSGal6ST, KSST

Gene Symbol

CHST1

UniProt

Additional Carbohydrate Sulfotransferase 1/CHST1 Products

Product Documents for Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody - BSA Free and earn rewards!

Have you used Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Articular Cartilage Extracellular Matrix
Articular Cartilage Extracellular Matrix Thumbnail