Carbohydrate Sulfotransferase 15/CHST15 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59012

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to GALNAC4S-6ST(B cell RAG associated protein) The peptide sequence was selected from the middle region of GALNAC4S-6ST. Peptide sequence YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Carbohydrate Sulfotransferase 15/CHST15 Antibody - BSA Free

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012]

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012]

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012]

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012]

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - Hela cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012]

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012]

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012]

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012]

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - MCF7, Antibody Dilution: 1.0 ug/ml CHST15 is supported by BioGPS gene expression data to be expressed in MCF7.

Applications for Carbohydrate Sulfotransferase 15/CHST15 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carbohydrate Sulfotransferase 15/CHST15

GALNAC4S-6ST is a sulfotransferase that transfers sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containing GlcA-GalNAc(4,6-SO(4)) repeating units. It also transfers sulfate to a unique non-reducing terminal sequence, GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), to yield a highly sulfated structure similar to the structure found in thrombomodulin chondroitin sulfate. GALNAC4S-6ST may also act as a B-cell receptor involved in BCR ligation-mediated early activation that mediate regulatory signals key to B-cell development and/or regulation of B-cell-specific RAG expression; however such results are unclear in vivo.

Alternate Names

BRAG, CHST15, GalNAc4S-6ST

Gene Symbol

CHST15

UniProt

Additional Carbohydrate Sulfotransferase 15/CHST15 Products

Product Documents for Carbohydrate Sulfotransferase 15/CHST15 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Carbohydrate Sulfotransferase 15/CHST15 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Carbohydrate Sulfotransferase 15/CHST15 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Carbohydrate Sulfotransferase 15/CHST15 Antibody - BSA Free and earn rewards!

Have you used Carbohydrate Sulfotransferase 15/CHST15 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Articular Cartilage Extracellular Matrix
Articular Cartilage Extracellular Matrix Thumbnail