Carbohydrate Sulfotransferase 15/CHST15 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59012

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Carbohydrate Sulfotransferase 15/CHST15 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GALNAC4S-6ST(B cell RAG associated protein) The peptide sequence was selected from the middle region of GALNAC4S-6ST. Peptide sequence YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Carbohydrate Sulfotransferase 15/CHST15 Antibody - BSA Free

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012]

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012]

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012]

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012]

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - Hela cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012]

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012]

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012]

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012]

Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-59012] - MCF7, Antibody Dilution: 1.0 ug/ml CHST15 is supported by BioGPS gene expression data to be expressed in MCF7.

Applications for Carbohydrate Sulfotransferase 15/CHST15 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carbohydrate Sulfotransferase 15/CHST15

GALNAC4S-6ST is a sulfotransferase that transfers sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containing GlcA-GalNAc(4,6-SO(4)) repeating units. It also transfers sulfate to a unique non-reducing terminal sequence, GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), to yield a highly sulfated structure similar to the structure found in thrombomodulin chondroitin sulfate. GALNAC4S-6ST may also act as a B-cell receptor involved in BCR ligation-mediated early activation that mediate regulatory signals key to B-cell development and/or regulation of B-cell-specific RAG expression; however such results are unclear in vivo.

Alternate Names

BRAG, CHST15, GalNAc4S-6ST

Gene Symbol

CHST15

UniProt

Q7LFX5

Additional Carbohydrate Sulfotransferase 15/CHST15 Products

Product Documents for Carbohydrate Sulfotransferase 15/CHST15 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Carbohydrate Sulfotransferase 15/CHST15 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Carbohydrate Sulfotransferase 15/CHST15 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Carbohydrate Sulfotransferase 15/CHST15 Antibody - BSA Free and earn rewards!

Have you used Carbohydrate Sulfotransferase 15/CHST15 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

Articular Cartilage Extracellular Matrix Articular Cartilage Extracellular Matrix Thumbnail