Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59944

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to CHST2(carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2) The peptide sequence was selected from the middle region of CHST2. Peptide sequence NAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free

Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-59944]

Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-59944]

Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-59944] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-59944]

Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-59944]

Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-59944] - 293T cells lysate, concentration 0.2-1 ug/ml.
Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-59944]

Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-59944]

Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-59944] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-59944]

Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-59944]

Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-59944] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-59944]

Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-59944]

Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-59944] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-59944]

Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-59944]

Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-59944] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Applications for Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carbohydrate Sulfotransferase 2/CHST2

N-acetylglucosamine-6-O-sulfotransferases, such as CHST2, catalyze the transfer of sulfate from 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS) to position 6 of a nonreducing N-acetylglucosamine (GlcNAc) residue.

Alternate Names

C6ST, CHST2, GlcNAc6ST-1, GN6ST, GST-2

Gene Symbol

CHST2

UniProt

Additional Carbohydrate Sulfotransferase 2/CHST2 Products

Product Documents for Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free and earn rewards!

Have you used Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Articular Cartilage Extracellular Matrix Articular Cartilage Extracellular Matrix Thumbnail