The CHST family is comprised of 14 genes in both human and mouse. All members of this family are Golgi-localized type II membrane proteins. Only the luminal and enzymatic domain is expressed in each of our recombinant CHST proteins. These enzymes transfer sulfate (i.e., sulfonate) onto the 6-O or 4-O positions of GalNAc, Gal and GlcNAc residues on glycoproteins, proteoglycans and glycolipids. This sulfation often creates specific epitopes that can be recognized by extracellular matrix proteins, cell surface receptors and viruses. Human CHST2, also known as N-acetylglucosamine-6-O-sulfotransferase 1 (GlcNAc6ST-1) and Gal/GalNAc/GlcNAc 6-O-sulfotransferase (GST-2), was previously shown to act on non-reducing GlcNAc residues. The enzyme is known to be involved in biosynthesis of L-selectin ligand sialyl 6-sulfo Lewis X and therefore plays a role in lymphocyte homing.
Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-79191
Loading...
Key Product Details
Species Reactivity
Mouse
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
The specific Immunogen is proprietary information. Peptide sequence VFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRV. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free
Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-79191]
Western Blot: Carbohydrate sulfotransferase 2 Antibody [NBP1-79191] - Mouse Brain Lysate 1ug/ml Gel Concentration 12%Applications for Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Carbohydrate Sulfotransferase 2/CHST2
Additional Carbohydrate Sulfotransferase 2/CHST2 Products
Product Documents for Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free and earn rewards!
Have you used Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...