Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79191

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The specific Immunogen is proprietary information. Peptide sequence VFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free

Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-79191]

Western Blot: Carbohydrate Sulfotransferase 2/CHST2 Antibody [NBP1-79191]

Western Blot: Carbohydrate sulfotransferase 2 Antibody [NBP1-79191] - Mouse Brain Lysate 1ug/ml Gel Concentration 12%

Applications for Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carbohydrate Sulfotransferase 2/CHST2

The CHST family is comprised of 14 genes in both human and mouse. All members of this family are Golgi-localized type II membrane proteins. Only the luminal and enzymatic domain is expressed in each of our recombinant CHST proteins. These enzymes transfer sulfate (i.e., sulfonate) onto the 6-O or 4-O positions of GalNAc, Gal and GlcNAc residues on glycoproteins, proteoglycans and glycolipids. This sulfation often creates specific epitopes that can be recognized by extracellular matrix proteins, cell surface receptors and viruses. Human CHST2, also known as N-acetylglucosamine-6-O-sulfotransferase 1 (GlcNAc6ST-1) and Gal/GalNAc/GlcNAc 6-O-sulfotransferase (GST-2), was previously shown to act on non-reducing GlcNAc residues. The enzyme is known to be involved in biosynthesis of L-selectin ligand sialyl 6-sulfo Lewis X and therefore plays a role in lymphocyte homing.

Alternate Names

C6ST, CHST2, GlcNAc6ST-1, GN6ST, GST-2

Gene Symbol

CHST2

Additional Carbohydrate Sulfotransferase 2/CHST2 Products

Product Documents for Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free and earn rewards!

Have you used Carbohydrate Sulfotransferase 2/CHST2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Articular Cartilage Extracellular Matrix
Articular Cartilage Extracellular Matrix Thumbnail