Carbohydrate Sulfotransferase 5/CHST5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17221

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Carbohydrate Sulfotransferase 5/CHST5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YRLVRFEDLAREPLAEIRALYAFTGLTLTPQLEAWIHNITHGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Carbohydrate Sulfotransferase 5/CHST5 Antibody - BSA Free

Immunohistochemistry-Paraffin: Carbohydrate Sulfotransferase 5/CHST5 Antibody [NBP3-17221]

Immunohistochemistry-Paraffin: Carbohydrate Sulfotransferase 5/CHST5 Antibody [NBP3-17221]

Immunohistochemistry-Paraffin: Carbohydrate Sulfotransferase 5/CHST5 Antibody [NBP3-17221] - Staining of human rectum shows moderate membranous and cytoplasmic positivity in glandular cells.

Applications for Carbohydrate Sulfotransferase 5/CHST5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carbohydrate Sulfotransferase 5/CHST5

CHST5 is a gene that codes for a protein with two isoforms, measuring 411 and 417 amino acids in length, with weights of approximately 46 and 47 kDa respectively. CHST5 functions as a sulfotransferase that does not transfer sulfate to longer carbohydrate structures nor does it have activity toward keratin. Current research is being done of several diseases and disorders related to this gene including corneal dystrophy, adenocarcinoma, esophagitis, cholesterol, immunodeficiency, and hepatitis. CHST5 has also been shown to have interactions with CHST1, KERA, LUM, ST#GAL3, and FMOD in pathways such as the metabolism, Maroteaux-Lamy syndrome, and Hunter syndrome pathways.

Alternate Names

CHST5, GlcNAc6ST3, GST4-alpha, hIGn6ST, I-GlcNAc6ST

Gene Symbol

CHST5

Additional Carbohydrate Sulfotransferase 5/CHST5 Products

Product Documents for Carbohydrate Sulfotransferase 5/CHST5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Carbohydrate Sulfotransferase 5/CHST5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Carbohydrate Sulfotransferase 5/CHST5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Carbohydrate Sulfotransferase 5/CHST5 Antibody - BSA Free and earn rewards!

Have you used Carbohydrate Sulfotransferase 5/CHST5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

Articular Cartilage Extracellular Matrix Articular Cartilage Extracellular Matrix Thumbnail