Carbohydrate Sulfotransferase 7/CHST7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87122

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Carbohydrate Sulfotransferase 7/CHST7. Peptide sequence: DLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQVLRTR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Carbohydrate Sulfotransferase 7/CHST7 Antibody - BSA Free

Western Blot: Carbohydrate Sulfotransferase 7/CHST7 Antibody [NBP2-87122]

Western Blot: Carbohydrate Sulfotransferase 7/CHST7 Antibody [NBP2-87122]

Western Blot: Carbohydrate Sulfotransferase 7/CHST7 Antibody [NBP2-87122] - WB Suggested Anti-CHST7 Antibody Titration: 1.25ug/ml. Positive Control: Jurkat cell lysate

Applications for Carbohydrate Sulfotransferase 7/CHST7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carbohydrate Sulfotransferase 7/CHST7

The CHST family is comprised of 14 genes in both human and mouse. All members of this family are Golgi-localized type II membrane proteins. Only the luminal and enzymatic domain is expressed in each of our recombinant CHST proteins. These enzymes transfer sulfate (i.e., sulfonate) onto the 6-O or 4-O positions of GalNAc, Gal and GlcNAc residues on glycoproteins, proteoglycans and glycolipids. This sulfation often creates specific epitopes that can be recognized by extracellular matrix proteins, cell surface receptors and viruses. CHST7, also designated as chondroitin 6-O-sulfotransferase (C6ST-2), N-acetylglucosamine-6-O-sulfotransferase (GlcNAc6ST-4) and Gal/GalNAc/GlcNAc 6-O-sulfotransferase (GST-5), was previously shown to act on chondroitin sulfate, mannose-linked GlcNAc and mucin associated GlcNAc residues. The amino acid sequence of mouse CHST7 is 87% identical to that of the human counterpart.

Alternate Names

C6ST2, CHST7, GlcNAc6ST-4, GST-5

Gene Symbol

CHST7

Additional Carbohydrate Sulfotransferase 7/CHST7 Products

Product Documents for Carbohydrate Sulfotransferase 7/CHST7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Carbohydrate Sulfotransferase 7/CHST7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Carbohydrate Sulfotransferase 7/CHST7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Carbohydrate Sulfotransferase 7/CHST7 Antibody - BSA Free and earn rewards!

Have you used Carbohydrate Sulfotransferase 7/CHST7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Articular Cartilage Extracellular Matrix Articular Cartilage Extracellular Matrix Thumbnail