The CHST family is comprised of 14 genes in both human and mouse. All members of this family are Golgi-localized type II membrane proteins. Only the luminal and enzymatic domain is expressed in each of our recombinant CHST proteins. These enzymes transfer sulfate (i.e., sulfonate) onto the 6-O or 4-O positions of GalNAc, Gal and GlcNAc residues on glycoproteins, proteoglycans and glycolipids. This sulfation often creates specific epitopes that can be recognized by extracellular matrix proteins, cell surface receptors and viruses. CHST7, also designated as chondroitin 6-O-sulfotransferase (C6ST-2), N-acetylglucosamine-6-O-sulfotransferase (GlcNAc6ST-4) and Gal/GalNAc/GlcNAc 6-O-sulfotransferase (GST-5), was previously shown to act on chondroitin sulfate, mannose-linked GlcNAc and mucin associated GlcNAc residues. The amino acid sequence of mouse CHST7 is 87% identical to that of the human counterpart.
Carbohydrate Sulfotransferase 7/CHST7 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-87122
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human Carbohydrate Sulfotransferase 7/CHST7. Peptide sequence: DLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQVLRTR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for Carbohydrate Sulfotransferase 7/CHST7 Antibody - BSA Free
Western Blot: Carbohydrate Sulfotransferase 7/CHST7 Antibody [NBP2-87122]
Western Blot: Carbohydrate Sulfotransferase 7/CHST7 Antibody [NBP2-87122] - WB Suggested Anti-CHST7 Antibody Titration: 1.25ug/ml. Positive Control: Jurkat cell lysateApplications for Carbohydrate Sulfotransferase 7/CHST7 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Carbohydrate Sulfotransferase 7/CHST7
Alternate Names
C6ST2, CHST7, GlcNAc6ST-4, GST-5
Gene Symbol
CHST7
Additional Carbohydrate Sulfotransferase 7/CHST7 Products
Product Documents for Carbohydrate Sulfotransferase 7/CHST7 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Carbohydrate Sulfotransferase 7/CHST7 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Carbohydrate Sulfotransferase 7/CHST7 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Carbohydrate Sulfotransferase 7/CHST7 Antibody - BSA Free and earn rewards!
Have you used Carbohydrate Sulfotransferase 7/CHST7 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...