Carbonic Anhydrase X/CA10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-31586

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Carbonic Anhydrase X/CA10 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: HRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Carbonic Anhydrase X/CA10 Antibody - BSA Free

Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586]

Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586]

Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human placenta shows no positivity in trophoblastic cells as expected.
Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586]

Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586]

Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells and moderate cytoplasmic nuclear in cells in molecular layer.
Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586]

Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586]

Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of liver cancer.
Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586]

Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586]

Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of pancreas.
Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586]

Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586]

Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586]

Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586]

Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586]

Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586]

Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Applications for Carbonic Anhydrase X/CA10 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carbonic Anhydrase X/CA10

CA10 encodes a protein that belongs to the carbonic anhydrase family of zinc metalloenzymes, which catalyze the reversible hydration of carbon dioxide in various biological processes. The protein encoded by this gene is an acatalytic member of the alpha-carbonic anhydrase subgroup, and it is thought to play a role in the central nervous system, especially in brain development. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Alternate Names

CA10, CARPX, HUCEP-15

Gene Symbol

CA10

UniProt

Q9NS85

Additional Carbonic Anhydrase X/CA10 Products

Product Documents for Carbonic Anhydrase X/CA10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Carbonic Anhydrase X/CA10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Carbonic Anhydrase X/CA10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Carbonic Anhydrase X/CA10 Antibody - BSA Free and earn rewards!

Have you used Carbonic Anhydrase X/CA10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies