Carboxyl Ester Lipase/CEL Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57922

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Carboxyl Ester Lipase/CEL Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C - terminal region of human Carboxyl Ester Lipase/CEL. Peptide Sequence VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Carboxyl Ester Lipase/CEL Antibody - BSA Free

Western Blot: Carboxyl Ester Lipase/CEL Antibody [NBP1-57922]

Western Blot: Carboxyl Ester Lipase/CEL Antibody [NBP1-57922]

Western Blot: Carboxyl Ester Lipase/CEL Antibody [NBP1-57922] - SH-SYSY cell lysate, concentration 0.2-1 ug/ml.

Applications for Carboxyl Ester Lipase/CEL Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carboxyl Ester Lipase/CEL

CEL catalyzes fat and vitamin absorption. CEL acts in concert with pancreatic lipase and colipase for the complete digestion of dietary triglycerides.The protein encoded by this gene is a glycoprotein secreted from the pancreas into the digestive tract and from the lactating mammary gland into human milk. The physiological role of this protein is in cholesterol and lipid-soluble vitamin ester hydrolysis and absorption. This encoded protein promotes large chylomicron production in the intestine. Also its presence in plasma suggests its interactions with cholesterol and oxidized lipoproteins to modulate the progression of atherosclerosis. In pancreatic tumoral cells, this encoded protein is thought to be sequestrated within the Golgi compartment and is probably not secreted. This gene contains a variable number of tandem repeat (VNTR) polymorphism in the coding region that may influence the function of the encoded protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

BAL, BSDL, BSSL, CEL, FAPP

Gene Symbol

CEL

Additional Carboxyl Ester Lipase/CEL Products

Product Documents for Carboxyl Ester Lipase/CEL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Carboxyl Ester Lipase/CEL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Bioactive Lipids and Receptors

Customer Reviews for Carboxyl Ester Lipase/CEL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Carboxyl Ester Lipase/CEL Antibody - BSA Free and earn rewards!

Have you used Carboxyl Ester Lipase/CEL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies