Carboxylesterase 3/CES3/Esterase 31 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98271

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Carboxylesterase 3/CES3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is Carboxylesterase 3 - middle region. Peptide sequence TPGIIDSHPWPLAQKIANTLACSSSSPAEMVQCLQQKEGEELVLSKKLKN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Carboxylesterase 3/CES3/Esterase 31 Antibody - BSA Free

Western Blot: Carboxylesterase 3/CES3/Esterase 31 Antibody [NBP1-98271]

Western Blot: Carboxylesterase 3/CES3/Esterase 31 Antibody [NBP1-98271]

Western Blot: Carboxylesterase 3/CES3/Esterase 31 Antibody [NBP1-98271] - THP-1 Cell Lysate, 1.0ug/ml, Gel Concentration: 12%

Applications for Carboxylesterase 3/CES3/Esterase 31 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carboxylesterase 3/CES3

This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This gene is expressed in several tissues, particularly in colon, trachea and in brain, and the protein participates in colon and neural drug metabolism. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported, but the biological validity and/or full-length nature of some variants have not been determined.

Alternate Names

CES3

Gene Symbol

CES3

UniProt

NP_079198 (Human)

Additional Carboxylesterase 3/CES3 Products

Product Documents for Carboxylesterase 3/CES3/Esterase 31 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Carboxylesterase 3/CES3/Esterase 31 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Carboxylesterase 3/CES3/Esterase 31 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Carboxylesterase 3/CES3/Esterase 31 Antibody - BSA Free and earn rewards!

Have you used Carboxylesterase 3/CES3/Esterase 31 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies