CASC4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84592

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CASC4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CASC4. Peptide sequence: FQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINNQV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CASC4 Antibody - BSA Free

Western Blot: CASC4 Antibody [NBP2-84592]

Western Blot: CASC4 Antibody [NBP2-84592]

Western Blot: CASC4 Antibody [NBP2-84592] - Host: Rabbit. Target Name: CASC4. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for CASC4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CASC4

The increased expression level of this gene is associated with HER-2/neu proto-oncogene overexpression. Amplification and resulting overexpression of this proto-oncogene are found in approximately 30% of human breast and 20% of human ovarian cancers. Further characterization of the product of this gene may yield insight into the fundamental biology and pathogenetic effects of HER-2/neu overexpression in human breast and ovarian cancer cells. Alternatively spliced variants encoding different isoforms have been identified for this gene. [provided by RefSeq]

Alternate Names

cancer susceptibility candidate 4, Cancer susceptibility candidate gene 4 protein, DKFZp459F1927, gene associated with HER-2/neu overexpression, H63, MGC74708, protein CASC4

Gene Symbol

CASC4

Additional CASC4 Products

Product Documents for CASC4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CASC4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CASC4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CASC4 Antibody - BSA Free and earn rewards!

Have you used CASC4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies