CASS4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10642

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CASS4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CASS4. Peptide sequence ALLARALYDNCPDCSDELAFSRGDILTILEQHVPESEGWWKCLLHGRQGL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CASS4 Antibody - BSA Free

Western Blot: CASS4 Antibody [NBP3-10642]

Western Blot: CASS4 Antibody [NBP3-10642]

Western Blot: CASS4 Antibody [NBP3-10642] - Western blot analysis of CASS4 in RPMI-8226 Whole Cell lysates. Antibody dilution at 1.0ug/ml.

Applications for CASS4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CASS4

Possible docking protein which may play a role for tyrosine-kinase-based signaling related to cell adhesion.Regulates FAK activity, focal adhesion integrity, and cell spreading

Alternate Names

C20orf32, Cas scaffolding protein family member 4, HEF1-EFS-p130Cas-like protein, HEFLchromosome 20 open reading frame 32, HEF-like protein, HEPLCAS4

Gene Symbol

CASS4

Additional CASS4 Products

Product Documents for CASS4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CASS4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CASS4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CASS4 Antibody - BSA Free and earn rewards!

Have you used CASS4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies