CAT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59857

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen for anti-SLC7A1 antibody: synthetic peptide directed towards the N terminal of human SLC7A1. Peptide sequence LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CAT1 Antibody - BSA Free

Western Blot: CAT1 Antibody [NBP1-59857]

Western Blot: CAT1 Antibody [NBP1-59857]

Western Blot: CAT1 Antibody [NBP1-59857] - Reccomended Titration: 1 ug/mL Sample Type: Human MDA-MB-435s
Western Blot: CAT1 Antibody [NBP1-59857]

Western Blot: CAT1 Antibody [NBP1-59857]

Western Blot: CAT1 Antibody [NBP1-59857] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: CAT1 Antibody [NBP1-59857]

Western Blot: CAT1 Antibody [NBP1-59857]

Western Blot: CAT1 Antibody [NBP1-59857] - Antibody Titration: 1 ug/ml Human 721_B.

Applications for CAT1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CAT1/SLC7A1

SLC7A1 is a high-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. It may also function as an ecotropic retroviral leukemia receptor.

Long Name

Cationic 1/Solute Carrier Family 7 Member 1

Alternate Names

ATRC1, HCAT1, REC1L, SLC7A1

Gene Symbol

SLC7A1

UniProt

Additional CAT1/SLC7A1 Products

Product Documents for CAT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CAT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CAT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CAT1 Antibody - BSA Free and earn rewards!

Have you used CAT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for CAT1 Antibody - BSA Free

Showing  1 - 3 of 3 FAQs Showing All
  • Q: Are you aware of any publications that have used these specific Abs? If yes, could you supply any relevant references?

    A: There are currently no product specific references associated with either one of these antibodies.

  • Q: What is the amino acid sequence and species of the immunogen?

    A: The immunogen sequence for NBP1-59857 is LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLN of the human protein. The epitope recognized by NBP1-90066 maps to the antigen sequence: QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV of the human protein.

  • Q: Will these antibodies react with the mouse Slc7a1 receptor for purposes of immunocytochemistry or immunohistochemistry? If yes, do you have any images you can send for examples of its application?

    A: NBP1-59857 has been validated for Western blot in human and pig tissue. NBP1-90066 has been validated for use in IHC-Paraffin in human tissue. We cannot guarantee that either of these antibodies will work in mouse IHC or ICC, however if you'd be interested in testing one of these antibodies in mouse IHC or ICC our Innovator's Rewards program may be of interest to you. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.

  • Q: Are you aware of any publications that have used these specific Abs? If yes, could you supply any relevant references?

    A: There are currently no product specific references associated with either one of these antibodies.

  • Q: What is the amino acid sequence and species of the immunogen?

    A: The immunogen sequence for NBP1-59857 is LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLN of the human protein. The epitope recognized by NBP1-90066 maps to the antigen sequence: QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV of the human protein.

  • Q: Will these antibodies react with the mouse Slc7a1 receptor for purposes of immunocytochemistry or immunohistochemistry? If yes, do you have any images you can send for examples of its application?

    A: NBP1-59857 has been validated for Western blot in human and pig tissue. NBP1-90066 has been validated for use in IHC-Paraffin in human tissue. We cannot guarantee that either of these antibodies will work in mouse IHC or ICC, however if you'd be interested in testing one of these antibodies in mouse IHC or ICC our Innovator's Rewards program may be of interest to you. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.

  • Q: Are you aware of any publications that have used these specific Abs? If yes, could you supply any relevant references?

    A: There are currently no product specific references associated with either one of these antibodies.

  • Q: What is the amino acid sequence and species of the immunogen?

    A: The immunogen sequence for NBP1-59857 is LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLN of the human protein. The epitope recognized by NBP1-90066 maps to the antigen sequence: QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV of the human protein.

  • Q: Will these antibodies react with the mouse Slc7a1 receptor for purposes of immunocytochemistry or immunohistochemistry? If yes, do you have any images you can send for examples of its application?

    A: NBP1-59857 has been validated for Western blot in human and pig tissue. NBP1-90066 has been validated for use in IHC-Paraffin in human tissue. We cannot guarantee that either of these antibodies will work in mouse IHC or ICC, however if you'd be interested in testing one of these antibodies in mouse IHC or ICC our Innovator's Rewards program may be of interest to you. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.

Showing  1 - 3 of 3 FAQs Showing All
View all FAQs for Antibodies
Loading...