![Western Blot: CAT1 Antibody [NBP1-59857]](https://resources.rndsystems.com/images/products/CAT1-Antibody-Western-Blot-NBP1-59857-img0004.jpg "Western Blot: CAT1 Antibody [NBP1-59857]")
Key Product Details
Species Reactivity
Applications
Label
Antibody Source
Format
Product Specifications
Immunogen
Clonality
Host
Isotype
Theoretical MW
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Scientific Data Images for CAT1 Antibody - BSA Free
Western Blot: CAT1 Antibody [NBP1-59857]
Western Blot: CAT1 Antibody [NBP1-59857] - Reccomended Titration: 1 ug/mL Sample Type: Human MDA-MB-435s![Western Blot: CAT1 Antibody [NBP1-59857]](https://resources.rndsystems.com/images/products/CAT1-Antibody-Western-Blot-NBP1-59857-img0002.jpg "Western Blot: CAT1 Antibody [NBP1-59857]")
Western Blot: CAT1 Antibody [NBP1-59857]
Western Blot: CAT1 Antibody [NBP1-59857] - Jurkat cell lysate, concentration 0.2-1 ug/ml.![Western Blot: CAT1 Antibody [NBP1-59857]](https://resources.rndsystems.com/images/products/CAT1-Antibody-Western-Blot-NBP1-59857-img0003.jpg "Western Blot: CAT1 Antibody [NBP1-59857]")
Western Blot: CAT1 Antibody [NBP1-59857]
Western Blot: CAT1 Antibody [NBP1-59857] - Antibody Titration: 1 ug/ml Human 721_B.Applications for CAT1 Antibody - BSA Free
Western Blot
Formulation, Preparation, and Storage
Purification
Formulation
Format
Preservative
Concentration
Shipping
Stability & Storage
Background: CAT1/SLC7A1
Long Name
Alternate Names
Gene Symbol
UniProt
Additional CAT1/SLC7A1 Products
Product Documents for CAT1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CAT1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for CAT1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CAT1 Antibody - BSA Free and earn rewards!
Have you used CAT1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for CAT1 Antibody - BSA Free
-
Q: Are you aware of any publications that have used these specific Abs? If yes, could you supply any relevant references?
A: There are currently no product specific references associated with either one of these antibodies.
-
Q: What is the amino acid sequence and species of the immunogen?
A: The immunogen sequence for NBP1-59857 is LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLN of the human protein. The epitope recognized by NBP1-90066 maps to the antigen sequence: QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV of the human protein.
-
Q: Will these antibodies react with the mouse Slc7a1 receptor for purposes of immunocytochemistry or immunohistochemistry? If yes, do you have any images you can send for examples of its application?
A: NBP1-59857 has been validated for Western blot in human and pig tissue. NBP1-90066 has been validated for use in IHC-Paraffin in human tissue. We cannot guarantee that either of these antibodies will work in mouse IHC or ICC, however if you'd be interested in testing one of these antibodies in mouse IHC or ICC our Innovator's Rewards program may be of interest to you. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.
-
Q: Are you aware of any publications that have used these specific Abs? If yes, could you supply any relevant references?
A: There are currently no product specific references associated with either one of these antibodies.
-
Q: What is the amino acid sequence and species of the immunogen?
A: The immunogen sequence for NBP1-59857 is LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLN of the human protein. The epitope recognized by NBP1-90066 maps to the antigen sequence: QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV of the human protein.
-
Q: Will these antibodies react with the mouse Slc7a1 receptor for purposes of immunocytochemistry or immunohistochemistry? If yes, do you have any images you can send for examples of its application?
A: NBP1-59857 has been validated for Western blot in human and pig tissue. NBP1-90066 has been validated for use in IHC-Paraffin in human tissue. We cannot guarantee that either of these antibodies will work in mouse IHC or ICC, however if you'd be interested in testing one of these antibodies in mouse IHC or ICC our Innovator's Rewards program may be of interest to you. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.
-
Q: Are you aware of any publications that have used these specific Abs? If yes, could you supply any relevant references?
A: There are currently no product specific references associated with either one of these antibodies.
-
Q: What is the amino acid sequence and species of the immunogen?
A: The immunogen sequence for NBP1-59857 is LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLN of the human protein. The epitope recognized by NBP1-90066 maps to the antigen sequence: QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV of the human protein.
-
Q: Will these antibodies react with the mouse Slc7a1 receptor for purposes of immunocytochemistry or immunohistochemistry? If yes, do you have any images you can send for examples of its application?
A: NBP1-59857 has been validated for Western blot in human and pig tissue. NBP1-90066 has been validated for use in IHC-Paraffin in human tissue. We cannot guarantee that either of these antibodies will work in mouse IHC or ICC, however if you'd be interested in testing one of these antibodies in mouse IHC or ICC our Innovator's Rewards program may be of interest to you. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.