Catenin alpha 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88777

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Catenin alpha 2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human Catenin alpha 2. Peptide sequence: YQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHIS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Catenin alpha 2 Antibody - BSA Free

Western Blot: Catenin alpha 2 Antibody [NBP2-88777]

Western Blot: Catenin alpha 2 Antibody [NBP2-88777]

Western Blot: Catenin alpha 2 Antibody [NBP2-88777] - Host: Rabbit. Target Name: CTNNA2. Sample Type: PANC1 Whole cell lysates. Antibody Dilution: 1.0ug/mlCTNNA2 is supported by BioGPS gene expression data to be expressed in PANC1

Applications for Catenin alpha 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Catenin alpha 2

It has been shown that alpha N-catenin, a linker between cadherin adhesion receptors and the actin cytoskeleton, is essential for stabilizing dendritic spines in rodent hippocampal neurons in culture. Results suggest that alpha N-catenin is a key regulator for the stability of synaptic contacts (1). We show here that antibodies against alpha catenin also immunoprecipitate complexes that contain human N-cadherin, mouse P-cadherin, chicken A-CAM (adherens junction-specific CAM; also called N-cadherin) or Xenopus U-cadherin, demonstrating that alpha catenin is complexed with other cadherins(2).

Alternate Names

Alpha-catenin-related protein, cancer/testis antigen 114, CAPRrelated, catenin (cadherin-associated protein), alpha 2, catenin alpha-2, CTNR, DKFZp686H02198

Gene Symbol

CTNNA2

Additional Catenin alpha 2 Products

Product Documents for Catenin alpha 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Catenin alpha 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Catenin alpha 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Catenin alpha 2 Antibody - BSA Free and earn rewards!

Have you used Catenin alpha 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies