Cathepsin Z Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87286

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Cathepsin Z Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Cathepsin Z. Peptide sequence SAARARLYFRSGQTCYHPIRGDQLALLGRRTYPRPHEYLSPADLPKNWDW The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Cathepsin Z Antibody - BSA Free

Western Blot: Cathepsin Z Antibody [NBP2-87286]

Western Blot: Cathepsin Z Antibody [NBP2-87286]

Western Blot: Cathepsin Z Antibody [NBP2-87286] - WB Suggested Anti-Ctsz Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Heart

Applications for Cathepsin Z Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cathepsin Z

Cathepsin Z is encoded by this gene is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. This gene is expressed ubiquitously in cancer cell lines and primary tumors and, like other members of this family, may be involved in tumorigenesis. At least two transcript variants of this gene have been found, but the full-length nature of only one of them has been determined.

Alternate Names

Cathepsin P, Cathepsin X, cathepsin Z, CTSX, EC 3.4.18.1, FLJ17088, preprocathepsin P

Gene Symbol

CTSZ

Additional Cathepsin Z Products

Product Documents for Cathepsin Z Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cathepsin Z Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cathepsin Z Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cathepsin Z Antibody - BSA Free and earn rewards!

Have you used Cathepsin Z Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies