CATIP Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10634

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CATIP Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf62 (NP_940961). Peptide sequence FLLFLLLRQPEDVVTFAAEFFGPFDPWRPSSPALGSSHRPNPFRSLEPEG

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CATIP Antibody - BSA Free

Western Blot: CATIP Antibody [NBP3-10634]

Western Blot: CATIP Antibody [NBP3-10634]

Western Blot: CATIP Antibody [NBP3-10634] - Western blot analysis using NBP3-10634 on Transfected 293T as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for CATIP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CATIP

Chromosome 2 is the second largest human chromosome. It makes up approximately 8% of the human genome and contains 237 million bases encoding over 1,400 genes. C2orf62 (chromosome 2 open reading frame 62), also known as MGC50811, is a 387 amino acid protein encoded by a gene that maps to human chromosome 2q35. The C2orf62 gene has been provisionally designated C2orf62 pending further characterization.

Alternate Names

C2orf62, chromosome 2 open reading frame 62, hypothetical protein LOC375307, MGC50811

Gene Symbol

CATIP

Additional CATIP Products

Product Documents for CATIP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CATIP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CATIP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CATIP Antibody - BSA Free and earn rewards!

Have you used CATIP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies