CCDC28A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87147

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CCDC28A Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC28A. Peptide sequence: EQMEHVRGMQEKLARLNLELYGELEELPEDKRKTASDSNLDRLLSDLEEL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CCDC28A Antibody - BSA Free

Western Blot: CCDC28A Antibody [NBP2-87147]

Western Blot: CCDC28A Antibody [NBP2-87147]

Western Blot: CCDC28A Antibody [NBP2-87147] - Host: Rabbit. Target Name: CCDC28A. Sample Type: A549 Whole cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: CCDC28A Antibody [NBP2-87147]

Western Blot: CCDC28A Antibody [NBP2-87147]

Western Blot: CCDC28A Antibody [NBP2-87147] - Host: Rabbit. Target: CCDC28A. Positive control (+): THP1 Cell Lysate (N30). Negative control (-): RPMI-8226 Cell Lysate (N12). Antibody concentration: 2ug/ml

Applications for CCDC28A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CCDC28A

CCDC28A is located in a region close to the locus of the pseudogene of chemokine (C-C motif) receptor-like 1 on chromosome 6. The specific function of this gene has not yet been determined. [provided by RefSeq]

Alternate Names

C6orf80, CCRL1APMGC131913, chemokine C-C motif receptor-like 1 adjacent, chromosome 6 open reading frame 80, coiled-coil domain containing 28A, coiled-coil domain-containing protein 28A, DKFZp586D0623

Gene Symbol

CCDC28A

Additional CCDC28A Products

Product Documents for CCDC28A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CCDC28A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CCDC28A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CCDC28A Antibody - BSA Free and earn rewards!

Have you used CCDC28A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies